You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292853 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length recombinant GUK1. |
Species/Host | Mouse |
Clonality | Polyclonal |
Tested applications | ELISA, WB |
Reactivity | Human |
Immunogen | GUK1 (AAH06249, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. |
Conjugation | Unconjugated |
Protein Sequence | MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA |
NCBI | AAH06249 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | 50 % glycerol |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (47.78 KDa).