You have no items in your shopping cart.
Cart summary
GUCA2B Recombinant Protein (Human)
Catalog Number: orb2050315
| Catalog Number | orb2050315 |
|---|---|
| Category | Proteins |
| Description | GUCA2B Recombinant Protein (Human) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 13.5 kDa |
| UniProt ID | Q16661 |
| Protein Sequence | VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL |
| Source | Mammalian Cells |
| NCBI | NP_009033 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | GCAP-II;guanylate cyclase activator 2B;prepro-urog Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human GUCA2B protein [orb246148]
Greater than 90% as determined by SDS-PAGE.
11.5 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mgHuman GUCA2B protein [orb244804]
Greater than 90% as determined by SDS-PAGE.
25.5 kDa
E.coli
20 μg, 100 μg, 1 mgHuman GUCA2B protein [orb246926]
Greater than 90% as determined by SDS-PAGE.
13.5 kDa
Mammalian cell
20 μg, 100 μg, 1 mgGUCA2B Recombinant Protein (Human) [orb2050316]
Greater than 90% as determined by SDS-PAGE.
13.5 kDa
Mammalian Cells
100 μgGUCA2B Recombinant Protein (Human) [orb2053785]
Greater than 90% as determined by SDS-PAGE.
25.5 kDa
E.coli
20 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
