GSTO1 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2291723
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human GSTO1 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: IF, WB
• Reactivity: Human, Mouse, Rat
• Immunogen: GSTO1 (NP_004823.1, 1 a.a. ~ 241 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
• NCBI: NP_004823.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in HeLa.

GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in Jurkat.

GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in NIH/3T3.

GSTO1 MaxPab polyclonal antibody. Western Blot analysis of GSTO1 expression in PC-12.

Immunofluorescence of purified MaxPab antibody to GSTO1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of GSTO1 expression in transfected 293T cell line by GSTO1 MaxPab polyclonal antibody. Lane 1: GSTO1 transfected lysate (26.51 KDa). Lane 2: Non-transfected lysate.