GSTM5 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2292861
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human GSTM5 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse
• Immunogen: GSTM5 (NP_000842.2, 1 a.a. ~ 218 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
• NCBI: NP_000842.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

GSTM5 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTM5 expression in mouse liver.

Western Blot analysis of GSTM5 expression in transfected 293T cell line by GSTM5 MaxPab polyclonal antibody. Lane 1: GSTM5 transfected lysate (25.70 KDa). Lane 2: Non-transfected lysate.