GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody

• Catalog Number: orb315135
• Category: Antibodies
• Description: GSTA1/GSTA2/GSTA3/GSTA4/GSTA5 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE), different from the related mouse and rat sequences by five amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Mouse, Rat Immunofluorescence, 2μg/ml, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 25722 MW
• UniProt ID: P08263
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Glutathione S-transferase A1; 2.5.1.18; GST HA sub
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of GSTA1/A2/A3/A4/A5 using anti-GSTA1/A2/A3/A4/A5 antibody.Lane 1:human HCCT tissue; 2:human HCCP tissue; 3:rat liver tissue; 4:rat RH35 cell; 5:mouse liver tissue.

IF analysis of GSTA1/A2/A3/A4/A5 using anti-GSTA1/A2/A3/A4/A5 antibody.GSTA1/A2/A3/A4/A5 was detected in paraffin-embedded section of mouse liver tissues.

IF analysis of GSTA1/A2/A3/A4/A5 using anti-GSTA1/A2/A3/A4/A5 antibody.GSTA1/A2/A3/A4/A5 was detected in paraffin-embedded section of rat liver tissues.