You have no items in your shopping cart.
Cart summary
GST Protein, Plasmodium falciparum, Recombinant (His)
Catalog Number: orb1976782
| Catalog Number | orb1976782 |
|---|---|
| Category | Proteins |
| Description | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May also function as a storage protein or ligandin for parasitotoxic ferriprotoporphyrin IX (hemin). GST Protein, Plasmodium falciparum, Recombinant (His) is expressed in yeast with N-10xHis tag. The predicted molecular weight is 27.3 kDa and the accession number is Q8MU52. |
| Tag | N-10xHis |
| Purity | 98.00% |
| MW | 27.3 kDa (predicted) |
| UniProt ID | Q8MU52 |
| Protein Sequence | MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVPILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNETTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSLKNFPLLKAHNEFISNLPNIKNYITNRKESVY |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Plasmodium falciparum |
| Biological Activity | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. May also function as a storage protein or ligandin for parasitotoxic ferriprotoporphyrin IX (hemin). GST Protein, Plasmodium falciparum, Recombinant (His) is expressed in yeast with N-10xHis tag. The predicted molecular weight is 27.3 kDa and the accession number is Q8MU52. |
| Expression Region | 1-211 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
