GSN monoclonal antibody (M01), clone 3G5

• Catalog Number: orb2292866
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GSN.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: GSN (AAH26033, 673 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: SNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA
• Tested applications: ELISA, IHC-P, IP, WB
• Clone Number: 3G5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH26033
• Expiration Date: 12 months from date of receipt.

Western Blot detection against Immunogen (37.84 KDa).

Detection limit for recombinant GST tagged GSN is approximately 0.03 ng/ml as a capture antibody.

GSN monoclonal antibody (M01), clone 3G5 Western Blot analysis of GSN expression in HeLa.

Immunoperoxidase of monoclonal antibody to GSN on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml]

Immunoprecipitation of GSN transfected lysate using anti-GSN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSN MaxPab rabbit polyclonal antibody.

Western Blot analysis of GSN expression in transfected 293T cell line by GSN monoclonal antibody (M01), clone 3G5. Lane 1: GSN transfected lysate (85.7 KDa). Lane 2: Non-transfected lysate.