GSC monoclonal antibody (M01), clone 4H7

• Catalog Number: orb2290643
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GSC.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4H7
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: GSC (NP_776248, 151 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS
• NCBI: NP_776248
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GSC is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to GSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Immunoprecipitation of GSC transfected lysate using anti-GSC monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GSC MaxPab rabbit polyclonal antibody.

Western Blot analysis of GSC expression in transfected 293T cell line by GSC monoclonal antibody (M01), clone 4H7. Lane 1: GSC transfected lysate(28.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.51 KDa).