GRK6 monoclonal antibody (M10), clone 8D4

• Catalog Number: orb2292876
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GRK6.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 8D4
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: GRK6 (AAH17272, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRF
• NCBI: AAH17272
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GRK6 is approximately 0.3 ng/ml as a capture antibody.

GRK6 monoclonal antibody (M10), clone 8D4 Western Blot analysis of GRK6 expression in Jurkat.

Western Blot detection against Immunogen (36.63 KDa).