GRK5 Antibody

• Catalog Number: orb316571
• Category: Antibodies
• Description: GRK5 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Gallus
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5 (393-429aa KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK), different from the related mouse and rat sequences by three amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 67787 MW
• UniProt ID: P34947
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: G protein-coupled receptor kinase 5;2.7.11.16;G pr
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of GRK5 using anti-GRK5 antibody.Lane 1:human HepG2 cell;2:human HeLa cell;3:human A549 cell;4:rat heart tissue;5:mouse heart tissue.

IHC analysis of GRK5 using anti-GRK5 antibody. GRK5 was detected in a paraffin-embedded section of rat cardiac muscle tissue.

IHC analysis of GRK5 using anti-GRK5 antibody. GRK5 was detected in a paraffin-embedded section of mouse lung tissue.

IHC analysis of GRK5 using anti-GRK5 antibody. GRK5 was detected in a paraffin-embedded section of human placenta tissue.