Gprc5d Rabbit Polyclonal Antibody

SKU: orb586684

Description

Rabbit polyclonal antibody to Gprc5d

Research Area

GPCR, Neuroscience, Signaling Pathways

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Mouse
Predicted Reactivity	Canine, Equine, Guinea pig, Human, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Gprc5d
Target	Gprc5d
Protein Sequence	Synthetic peptide located within the following region: MDTQEPTRARDSDGAQEDVALTAYGTPIQLQSADPSREYLIPSATLSPQQ
Molecular Weight	37kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Mouse Thymus lysates, Antibody dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

Gprc5d

UniProt

Q9JIL6

RefSeq (Protein):NP_001192325

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_001192325

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols