You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb527018 |
---|---|
Category | Antibodies |
Description | GPR2/CCR10 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human GPR2/CCR10 (TEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQ). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 45 kDa |
UniProt ID | P46092 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | C-C chemokine receptor type 10; C-C CKR-10; CC-CKR Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB analysis of CCR10 using anti-CCR10 antibody.Lane 1:human HeLa cell;2:human K562 cell;3:human PC-3 cell;4:human A549 cell;5:human T-47D cell.
IHC analysis of CCR10 using anti-CCR10 antibody.CCR10 was detected in paraffin-embedded section of human oesophagus squama cancer tissue.
IHC analysis of CCR10 using anti-CCR10 antibody.CCR10 was detected in paraffin-embedded section of human prostatic cancer tissue.
IHC analysis of CCR10 using anti-CCR10 antibody.CCR10 was detected in paraffin-embedded section of human tonsil tissue.
Filter by Rating