GPR2/CCR10 Antibody

• Catalog Number: orb527018
• Category: Antibodies
• Description: GPR2/CCR10 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human GPR2/CCR10 (TEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQ).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 45 kDa
• UniProt ID: P46092
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: C-C chemokine receptor type 10; C-C CKR-10; CC-CKR
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB analysis of CCR10 using anti-CCR10 antibody.Lane 1:human HeLa cell;2:human K562 cell;3:human PC-3 cell;4:human A549 cell;5:human T-47D cell.

IHC analysis of CCR10 using anti-CCR10 antibody.CCR10 was detected in paraffin-embedded section of human oesophagus squama cancer tissue.

IHC analysis of CCR10 using anti-CCR10 antibody.CCR10 was detected in paraffin-embedded section of human prostatic cancer tissue.

IHC analysis of CCR10 using anti-CCR10 antibody.CCR10 was detected in paraffin-embedded section of human tonsil tissue.