You have no items in your shopping cart.
Cart summary
GPD2 Protein, Candida albicans, Recombinant (His)
Catalog Number: orb1979575
| Catalog Number | orb1979575 |
|---|---|
| Category | Proteins |
| Description | GPD2 Protein, Candida albicans, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 42.3 kDa and the accession number is Q59W33. |
| Tag | C-6xHis |
| Purity | 87.00% |
| Protein Sequence | MTTSPYPIETPFKVCIVGSGNWGTAVAKLVAENCAEKPNIFQRDVKMWVFEEEIEGRKLTEIINTEHENVKYLPEIKLPTNLVANPDIVDTVQDADLIVFNIPHQFLGRIVKQIEGKVKPTARAISCLKGLDVSPEGCKLLSTSITDTLKIYCGVLSGANIANEVAKGNWSETSIAYTVPEDFRGAGKDIDPFILKEAFHRPYFHVRVIEDVVGASIAGALKNVIACSVGFVEGAGWGDNAKAAIMRIGIKETIRFASYWELFKIKALSPPNPKTFTEESAGVADLITTCSGGRNVKVARYMIKNNVDAFEAEKIVLKGQSSQGILTAKEVHELLTNFNLQDEFPLLEATYKVIYENGSVDDFPQLLEGDQ |
| UniProt ID | Q59W33 |
| MW | 42.3 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Candida albicans |
| Biological Activity | GPD2 Protein, Candida albicans, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 42.3 kDa and the accession number is Q59W33. |
| Expression Region | 1-371 aa |
| Storage | -20°C |
| Note | For research use only |
