GPCR RDC1/CXCR-7/ACKR3 Antibody

• Catalog Number: orb1291687
• Category: Antibodies
• Description: GPCR RDC1/CXCR-7/ACKR3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IHC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human GPCR RDC1/CXCR-7/ACKR3 (RNYRYELMKAFIFKYSAKTGLTKLIDASRVSE).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.25-0.5 μg/ml, Human Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Human Flow Cytometry, 1-3 μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 41 kDa
• UniProt ID: P25106
• Storage: At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing.
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Expiration Date: 12 months from date of receipt.

IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody. GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human breast cancer tissue.

IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody. GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human colon adenocarcinoma tissue.

IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody. GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human endometrial cancer tissue.

IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody. GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human urothelial carcinoma tissue.

IHC analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody. GPCR RDC1/CXCR-7/ACKR3 was detected in a paraffin-embedded section of human tonsil tissue.

Western blot analysis of GPCR RDC1/CXCR-7/ACKR3 using anti-GPCR RDC1/CXCR-7/ACKR3 antibody.

Flow Cytometry analysis of SiHa cells using anti-GPCR RDC1/CXCR-7/ACKR3 antibody(Blue line).Isotype control antibody(Green line) was rabbit IgG.Unlabelled sample(Red line) was also used as a control.