GPC3 Antibody : HRP

• Catalog Number: orb2070791
• Category: Antibodies
• Description: GPC3 Antibody : HRP
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, WB
• Immunogen: The antiserum was produced against synthesized peptide derived from the Internal region of human GPC3.
• Form/Appearance: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Conjugation: HRP
• MW: 65 kDa
• UniProt ID: P51654
• Protein Sequence: Synthetic peptide located within the following region: QIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSG
• Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Buffer/Preservatives: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Alternative names: SGB, DGSX, MXR7, SDYS, SGBS, OCI-5, SGBS1, GTR2-2
• Note: For research use only
• Application notes: Application Info: WB: 1:500~1:1000ELISA: 1:10000
• Expiration Date: 12 months from date of receipt.