GP1BA monoclonal antibody (M02), clone 1C6

• Catalog Number: orb2292880
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GP1BA.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: GP1BA (AAH27955, 19 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: ICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVPFNRL
• Tested applications: ELISA, IP, WB
• Clone Number: 1C6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH27955

Detection limit for recombinant GST tagged GP1BA is approximately 0.03 ng/ml as a capture antibody.

Immunoprecipitation of GP1BA transfected lysate using anti-GP1BA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GP1BA MaxPab rabbit polyclonal antibody.

Western Blot detection against Immunogen (37.84 KDa).