GOLM1 monoclonal antibody (M06), clone 5B10

• Catalog Number: orb2291146
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GOLM1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5B10
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: GOLM1 (NP_057632, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
• NCBI: NP_057632
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GOLM1 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to GOLM1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to GOLM1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]

Western Blot analysis of GOLM1 expression in transfected 293T cell line by GOLM1 monoclonal antibody (M06), clone 5B10. Lane 1: GOLM1 transfected lysate(45.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).