GOLM1 monoclonal antibody (M04), clone 3B10

• Catalog Number: orb2291147
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GOLM1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B10
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: GOLM1 (NP_057632, 302 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
• NCBI: NP_057632
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GOLM1 is 0.1 ng/ml as a capture antibody.

Immunoprecipitation of GOLM1 transfected lysate using anti-GOLM1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GOLM1 MaxPab rabbit polyclonal antibody.

Western Blot analysis of GOLM1 expression in transfected 293T cell line by GOLPH2 monoclonal antibody (M04), clone 3B10. Lane 1: GOLM1 transfected lysate(45.3 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).