GNAQ Antibody (monoclonal, 13H4)

• Catalog Number: orb527048
• Category: Antibodies
• Description: GNAQ Antibody (monoclonal, 13H4)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 13H4
• Tested applications: FC, IHC, WB
• Reactivity: Human, Monkey, Mouse, Rat
• Isotype: Mouse IgG2b
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 42 kDa
• UniProt ID: P50148
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Guanine nucleotide-binding protein G (q) subunit a
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of U20S cells using anti-GNAQ antibody (Blue line).Isotype control antibody (Green line) was mouse IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis anti-GNAQ antibody.Lane 1:human Jurkat cell;2:human HeLa cell;3:human A549 cell.4:human A431 cell;5:human MCF-7 cell;6:human K562 cell;7:monkey COS-7 cell;8:rat brain tissue;9:rat lung tissue;10:mouse brain tissue;11:mouse lung tissue.

IHC analysis of GNAQ using anti GNAQ antibody. GNAQ was detected in paraffin-embedded section of human ovarian cancer tissue.

IHC analysis of GNAQ using anti GNAQ antibody. GNAQ was detected in paraffin-embedded section of human ovarian cancer tissue.

IHC analysis of GNAQ using anti GNAQ antibody. GNAQ was detected in paraffin-embedded section of mouse testis tissue.