GNA14 monoclonal antibody (M06A), clone 2H8

• Catalog Number: orb2291687
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GNA14.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2H8
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: GNA14 (AAH27886.1, 150 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKAL
• NCBI: AAH27886.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of GNA14 expression in transfected 293T cell line by GNA14 monoclonal antibody (M06A), clone 2H8. Lane 1: GNA14 transfected lysate (41.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).