GMPS monoclonal antibody (M01), clone 1D10

• Catalog Number: orb2291819
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GMPS.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D10
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: GMPS (NP_003866, 108 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSG
• NCBI: NP_003866
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GMPS is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to GMPS on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]

Western Blot detection against Immunogen (37.62 KDa).