You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291174 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant GMNN. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1A8 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI |
NCBI | AAH05185 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged GMNN is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to GMNN on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]
Western Blot analysis of GMNN expression in transfected 293T cell line by GMNN monoclonal antibody (M01), clone 1A8. Lane 1: GMNN transfected lysate(23.6 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.63 KDa).