GMNN monoclonal antibody (M01), clone 1A8

• Catalog Number: orb2291174
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GMNN.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1A8
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
• NCBI: AAH05185
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GMNN is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to GMNN on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]

Immunoperoxidase of monoclonal antibody to GMNN on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]

Western Blot analysis of GMNN expression in transfected 293T cell line by GMNN monoclonal antibody (M01), clone 1A8. Lane 1: GMNN transfected lysate(23.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).