GLUD2 monoclonal antibody (M01), clone 3C2

• Catalog Number: orb2292892
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant GLUD2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3C2
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: GLUD2 (AAH05111.1, 1 a.a. ~ 264 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT
• NCBI: AAH05111.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GLUD2 is 0.3 ng/ml as a capture antibody.

GLUD2 monoclonal antibody (M01), clone 3C2. Western Blot analysis of GLUD2 expression in human pancreas.

Immunoperoxidase of monoclonal antibody to GLUD2 on formalin-fixed paraffin-embedded human ovarian cancer. [antibody concentration 1 ug/ml]

Immunoprecipitation of GLUD2 transfected lysate using anti-GLUD2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GLUD2 MaxPab rabbit polyclonal antibody.

Western Blot analysis of GLUD2 expression in transfected 293T cell line by GLUD2 monoclonal antibody (M01), clone 3C2. Lane 1: GLUD2 transfected lysate (61 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (54.78 KDa).