You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb381071 |
---|---|
Category | Antibodies |
Description | Glucose 6 phosphate isomerase/GPI Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Mouse |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of mouse GPI (2-39aa AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNN), different from the related human sequence by sixteen amino acids, and from the related rat sequence by two amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Mouse |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 62767 MW |
UniProt ID | P06745 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Glucose-6-phosphate isomerase;GPI;5.3.1.9;Autocrin Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of GPI using anti-GPI antibody.Lane 1:mouse HEPA1-6 cell; 2:mouse NIH/3T3 cell; 3:mouse spleen tissue; 4:mouse kidney tissue; 5:mouse thymus tissue.
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating