You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb312252 |
---|---|
Category | Antibodies |
Description | Glucagon antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ELISA |
Predicted Reactivity | Human |
Isotype | IgG |
Immunogen | KLH conjugated synthetic peptide derived from human GRPP(C-RSLQDTEEKSRSFSASQADPLSDPDQMNED) (21-50/180 aa) |
Concentration | 1mg/ml |
Form/Appearance | Liquid |
Conjugation | Unconjugated |
MW | 3.3 kDa |
Target | GRPP |
UniProt ID | P01275 |
Storage | Shipped at 4°C. Store at -20 °C for one year. Avoid repeated freeze/thaw cycles. |
Buffer/Preservatives | 0.01M TBS(pH7.4) with 1% rAlbumin, 0.03% Proclin300 and 50% Glycerol. |
Alternative names | glicentin-related polypeptide; GCG; Glicentin rela Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ICC, IF, IHC-P, WB | |
Guinea pig, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IHC | |
Hamster | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, FC, IF, WB | |
Bovine, Canine, Human, Mouse, Porcine, Rat | |
Goat | |
Polyclonal | |
Unconjugated |
ELISA, IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating