You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291540 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant GLRX3. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4B5-2A8 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG1 kappa |
Immunogen | GLRX3 (AAH05289, 1 a.a. ~ 335 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN |
NCBI | AAH05289 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
GLRX3 monoclonal antibody (M01), clone 4B5-2A8 Western Blot analysis of GLRX3 expression in Hela.
Western Blot detection against Immunogen (62.59 KDa).