GLRX monoclonal antibody (M02), clone 3C11

• Catalog Number: orb2292893
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GLRX.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3C11
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: GLRX (AAH10965, 1 a.a. ~ 106 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
• NCBI: AAH10965
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GLRX is approximately 0.1 ng/ml as a capture antibody.

GLRX monoclonal antibody (M01), clone 3C11 Western Blot analysis of GLRX expression in Jurkat.

Immunoperoxidase of monoclonal antibody to GLRX on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 ug/ml]

Western Blot detection against Immunogen (37.4 KDa).