You have no items in your shopping cart.
Cart summary
GLP2R Protein, Human, Recombinant (His)
Catalog Number: orb1978529
| Catalog Number | orb1978529 |
|---|---|
| Category | Proteins |
| Description | This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. GLP2R Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 22.0 kDa and the accession number is O95838. |
| Tag | C-10xHis |
| Purity | 98.00% |
| MW | 22.0 kDa (predicted) |
| UniProt ID | O95838 |
| Protein Sequence | MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVSIKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPSYLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYA |
| Expression System | HEK293 Cells |
| Biological Origin | Human |
| Biological Activity | This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. GLP2R Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-10xHis tag. The predicted molecular weight is 22.0 kDa and the accession number is O95838. |
| Expression Region | 1-173 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human GLP2R Protein, His Tag [orb1826736]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 20.1 kDa after removal of the signal peptide.
Mammalian
50 μg, 100 μg, 10 μg
