You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290982 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant GKN1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2E5 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG1 kappa |
Immunogen | GKN1 (AAH59778, 21 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN |
NCBI | AAH59778 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged GKN1 is approximately 0.1 ng/ml as a capture antibody.
Western Blot analysis of GKN1 expression in transfected 293T cell line by GKN1 monoclonal antibody (M01), clone 2E5. Lane 1: GKN1 transfected lysate(20 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (43.89 KDa).