GKN1 monoclonal antibody (M01), clone 2E5

• Catalog Number: orb2290982
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant GKN1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: GKN1 (AAH59778, 21 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
• NCBI: AAH59778
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GKN1 is approximately 0.1 ng/ml as a capture antibody.

Western Blot analysis of GKN1 expression in transfected 293T cell line by GKN1 monoclonal antibody (M01), clone 2E5. Lane 1: GKN1 transfected lysate(20 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (43.89 KDa).