You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1140534 |
---|---|
Category | Proteins |
Description | Competes with GIP for the receptor binding site; Peptides. |
CAS Number | 1802086-25-4 |
Form/Appearance | Freeze dried solid |
Purity | > 95% by HPLC |
MW | 4749.4 Da |
Formula | C214H324N58O63S |
Solubility (25°C) | Soluble in dilute acid |
Protein Sequence | EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Storage | Store dessicated and frozen in the dark |
Alternative names | 1802086-25-4, EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKH Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Filter by Rating