GHRL monoclonal antibody (M01), clone 2F4

• Catalog Number: orb2291114
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant GHRL.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F4
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: GHRL (AAH25791.1, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
• NCBI: AAH25791.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GHRL is approximately 0.1 ng/ml as a capture antibody.

GHRL monoclonal antibody (M01), clone 2F4. Western Blot analysis of GHRL expression in HeLa.

Immunoperoxidase of monoclonal antibody to GHRL on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]

Western Blot detection against Immunogen (38.61 KDa).