You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2050832 |
---|---|
Category | Proteins |
Description | GFER Recombinant Protein (Rat) |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 38.8 kDa |
UniProt ID | Q63042 |
Protein Sequence | MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD |
Source | E.coli |
NCBI | NP_037354 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | ALR;augmenter of liver regeneration;FAD-linked sul Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
38.8 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
38.8 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
38.8 kDa | |
E.coli |
98.00% | |
38.8 kDa (predicted) |
Filter by Rating