GEMIN7 Antibody

• Catalog Number: orb2236188
• Category: Antibodies
• Description: GEMIN7 Antibody
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4H6
• Tested applications: ELISA, IF, IP, WB
• Isotype: IgG2a Kappa
• Immunogen: GEMIN7 (NP_078983.1, 43 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Form/Appearance: Liquid
• Conjugation: Unconjugated
• Protein Sequence: ECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
• NCBI: NP_078983.1
• Storage: Store at -2°C or lower. Aliquot to avoid repeated freezing and thawing.
• Buffer/Preservatives: Liquid
• Alternative names: gem-associated protein 7;gemin-7;SIP3.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.