GATA2 monoclonal antibody (M01), clone 2D11

• Catalog Number: orb2292917
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GATA2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: GATA2 (AAH18988, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK
• Tested applications: ELISA, IF, WB
• Clone Number: 2D11
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH18988

Detection limit for recombinant GST tagged GATA2 is approximately 0.03 ng/ml as a capture antibody.

GATA2 monoclonal antibody (M01), clone 2D11 Western Blot analysis of GATA2 expression in Hela S3 NE.

Immunofluorescence of monoclonal antibody to GATA2 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of GATA2 expression in transfected 293T cell line by GATA2 monoclonal antibody (M01), clone 2D11. Lane 1: GATA2 transfected lysate (50.5 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of GATA2 over-expressed 293 cell line, cotransfected with GATA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GATA2 monoclonal antibody (M01), clone 2D11 (Cat # orb2292917). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.96 KDa).