You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292917 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant GATA2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | GATA2 (AAH18988, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGK |
Tested applications | ELISA, IF, WB |
Clone Number | 2D11 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH18988 |
Detection limit for recombinant GST tagged GATA2 is approximately 0.03 ng/ml as a capture antibody.
GATA2 monoclonal antibody (M01), clone 2D11 Western Blot analysis of GATA2 expression in Hela S3 NE.
Immunofluorescence of monoclonal antibody to GATA2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of GATA2 expression in transfected 293T cell line by GATA2 monoclonal antibody (M01), clone 2D11. Lane 1: GATA2 transfected lysate (50.5 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of GATA2 over-expressed 293 cell line, cotransfected with GATA2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GATA2 monoclonal antibody (M01), clone 2D11 (Cat # orb2292917). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (36.96 KDa).