GAS2 monoclonal antibody (M01), clone 4E11

• Catalog Number: orb2292918
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GAS2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4E11
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Mouse
• Isotype: IgG2a Kappa
• Immunogen: GAS2 (NP_005247, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFAR
• NCBI: NP_005247
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GAS2 is approximately 0.03 ng/ml as a capture antibody.

GAS2 monoclonal antibody (M01), clone 4E11 Western Blot analysis of GAS2 expression in NIH/3T3.

Immunofluorescence of monoclonal antibody to GAS2 on NIH/3T3 cell. [antibody concentration 10 ug/ml]

Western Blot analysis of GAS2 expression in transfected 293T cell line by GAS2 monoclonal antibody (M01), clone 4E11. Lane 1: GAS2 transfected lysate (34.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).