You have no items in your shopping cart.
Cart summary
Item 1 of 4
Item 1 of 4
GAPDH monoclonal antibody (M03), clone 1G5
Catalog Number: orb2292922
| Catalog Number | orb2292922 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant GAPDH. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG1 Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE |
| Tested applications | ELISA, IP, WB |
| Clone Number | 1G5 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_002037 |
Detection limit for recombinant GST tagged GAPDH is approximately 1 ng/ml as a capture antibody.
GAPDH monoclonal antibody (M03), clone 1G5. Western Blot analysis of GAPDH expression in HeLa.
Immunoprecipitation of GAPDH transfected lysate using anti-GAPDH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GAPDH MaxPab rabbit polyclonal antibody.
Western Blot detection against Immunogen (37.84 KDa).
