GAPDH monoclonal antibody (M01A), clone 3C2

• Catalog Number: orb2292923
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GAPDH.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: In ascites fluid
• Immunogen: GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
• Tested applications: ELISA, WB
• Clone Number: 3C2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_002037

GAPDH monoclonal antibody (M01A), clone 3C2 Western Blot analysis of GAPDH expression in A-431.

GAPDH monoclonal antibody (M01A), clone 3C2. Western Blot analysis of GAPDH expression in HeLa.

Western Blot analysis of GAPDH expression in transfected 293T cell line by GAPDH monoclonal antibody (M01A), clone 3C2. Lane 1: GAPDH transfected lysate (36.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).