GADD45G Antibody

• Catalog Number: orb412992
• Category: Antibodies
• Description: GADD45G Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human GADD45G (MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQ).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot,0.1-0.5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 19 kDa
• UniProt ID: O95257
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Growth arrest and DNA damage-inducible protein GAD
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of GADD45G using anti-GADD45G antibody.Lane 1:rat brain tissue;2:rat heart tissue;3:rat testis tissue;4:rat skeletal muscle tissue;5:mouse brain tissue;6:mouse heart tissue;7:mouse testis tissue;8:mouse skeletal muscle tissue.

WB analysis of GADD45G using anti-GADD45G antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human SW620 cell;4:human A549 cell;5:mouse NIH3T3 cell.