GADD45A monoclonal antibody (M01), clone 3D12

• Catalog Number: orb2293699
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GADD45A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D12
• Tested applications: ELISA, PLA, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: GADD45A (AAH11757, 76 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
• NCBI: AAH11757
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Proximity Ligation Analysis of protein-protein interactions between MAP2K6 and GADD45A. HeLa cells were stained with anti-MAP2K6 rabbit purified polyclonal 1:1200 and anti-GADD45A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (35.53 KDa).