GAD65/GAD2 Antibody

• Catalog Number: orb389475
• Category: Antibodies
• Description: GAD65/GAD2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 65411 MW
• UniProt ID: Q05329
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Glutamate decarboxylase 2;4.1.1.15;65 kDa glutamic
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of GAD65 using anti-GAD65 antibody.Lane 1:rat brain tissue;2:mouse brain tissue.

IHC analysis of GAD65 using anti-GAD65 antibody. GAD65 was detected in paraffin-embedded section of rat kidney tissues.

IHC analysis of GAD65 using anti-GAD65 antibody. GAD65 was detected in paraffin-embedded section of human mammary cancer tissues.

IHC analysis of GAD65 using anti-GAD65 antibody. GAD65 was detected in paraffin-embedded section of human intetsinal cancer tissues.