Cart summary

You have no items in your shopping cart.

GABRB1 Peptide - middle region

GABRB1 Peptide - middle region

Catalog Number: orb1998906

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1998906
CategoryProteins
DescriptionGABRB1 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW54 kDa
UniProt IDP18505
Protein SequenceSynthetic peptide located within the following region: DYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSF
NCBINP_000803.2
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
NoteFor research use only
Expiration Date6 months from date of receipt.