GABA Transporter 1/GAT 1/SLC6A1 Antibody

• Catalog Number: orb402560
• Category: Antibodies
• Description: GABA Transporter 1/GAT 1/SLC6A1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SLC6A1 (23-54aa ANDKPKTLVVKVQKKAADLPDRDTWKGRFDFL), different from the related mouse and rat sequences by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 67074 MW
• UniProt ID: P30531
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Sodium- and chloride-dependent GABA transporter 1;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of SLC6A1 using anti-SLC6A1 antibody.Lane 1:rat brain Tissue;2:mouse brain Tissue.