FZD5 monoclonal antibody (M01), clone 6A3

• Catalog Number: orb2291938
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FZD5.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6A3
• Tested applications: ELISA, IP, PLA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: FZD5 (ENSP00000354607, 72 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR
• NCBI: ENSP00000354607
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FZD5 is approximately 0.3 ng/ml as a capture antibody.

Immunoprecipitation of FZD5 transfected lysate using anti-FZD5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FZD5 MaxPab rabbit polyclonal antibody.

Proximity Ligation Analysis of protein-protein interactions between WNT5A and FZD5. HeLa cells were stained with anti-WNT5A rabbit purified polyclonal 1:1200 and anti-FZD5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody (M01), clone 6A3. Lane 1: FZD5 transfected lysate (64.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.64 KDa).