You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291938 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant FZD5. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 6A3 |
Tested applications | ELISA, IP, PLA, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | FZD5 (ENSP00000354607, 72 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR |
NCBI | ENSP00000354607 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged FZD5 is approximately 0.3 ng/ml as a capture antibody.
Immunoprecipitation of FZD5 transfected lysate using anti-FZD5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FZD5 MaxPab rabbit polyclonal antibody.
Proximity Ligation Analysis of protein-protein interactions between WNT5A and FZD5. HeLa cells were stained with anti-WNT5A rabbit purified polyclonal 1:1200 and anti-FZD5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody (M01), clone 6A3. Lane 1: FZD5 transfected lysate (64.5 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.64 KDa).