FYB2 Antibody - N-terminal region

• Catalog Number: orb2258218
• Category: Antibodies
• Description: FYB2 Antibody - N-terminal region
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C1orf168
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• UniProt ID: Q5VWT5
• Protein Sequence: Synthetic peptide located within the following region: KFPAGVSPKGDIGGTQSTQILANGKPLSSNHKQRTPYCSSSESQPLQPQK
• NCBI: NP_001004303
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ARAP, C1orf168
• Note: For research use only
• Expiration Date: 12 months from date of receipt.