You have no items in your shopping cart.
Cart summary
FXYD2 Recombinant Protein (Human)
Catalog Number: orb2051267
| Catalog Number | orb2051267 |
|---|---|
| Category | Proteins |
| Description | FXYD2 Recombinant Protein (Human) |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 34.4 kDa |
| UniProt ID | P54710 |
| Protein Sequence | MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
| Source | E.coli |
| NCBI | NP_001671 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | ATP1G1;ATPase, Na+/K+ transporting, gamma 1 polype Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human FXYD2 protein [orb54478]
Greater than 90% as determined by SDS-PAGE.
34.4 kDa
E.coli
20 μg, 100 μg, 1 mgFXYD2 Recombinant Protein (Human) [orb2051266]
Greater than 90% as determined by SDS-PAGE.
34.4 kDa
E.coli
20 μgFXYD2 Recombinant Protein (Human) [orb2051268]
Greater than 90% as determined by SDS-PAGE.
34.4 kDa
E.coli
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
