FXN monoclonal antibody (M03), clone 3G9

• Catalog Number: orb2292960
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FXN.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3G9
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: FXN (AAH48097.1, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL
• NCBI: AAH48097.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot analysis of FXN expression in transfected 293T cell line by FXN monoclonal antibody (M03), clone 3G9. Lane 1: FXN transfected lysate (23.1 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of FXN over-expressed 293 cell line, cotransfected with FXN Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FXN monoclonal antibody (M03), clone 3G9 (Cat # orb2292960). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (37.84 KDa).