FRZB purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2292955
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human FRZB protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: FRZB (NP_001454.2, 1 a.a. ~ 325 a.a) full-length human protein.
• Protein Sequence: MVCGSPGGMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001454.2

FRZB MaxPab rabbit polyclonal antibody. Western Blot analysis of FRZB expression in mouse liver.

FRZB MaxPab rabbit polyclonal antibody. Western Blot analysis of FRZB expression in NIH/3T3.

FRZB MaxPab rabbit polyclonal antibody. Western Blot analysis of FRZB expression in PC-12.

FRZB MaxPab rabbit polyclonal antibody. Western Blot analysis of FRZB expression in Raw 264.7.

Western Blot analysis of FRZB expression in transfected 293T cell line by FRZB MaxPab polyclonal antibody. Lane 1: FRZB transfected lysate (36.30 KDa). Lane 2: Non-transfected lysate.