Frizzled 4/FZD4 Antibody

• Catalog Number: orb402495
• Category: Antibodies
• Description: Frizzled 4/FZD4 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 65 kDa
• UniProt ID: Q9ULV1
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Frizzled-4; Fz-4; hFz4; FzE4; CD344; FZD4
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of Frizzled 4 using anti-Frizzled 4 antibody.Lane 1:human placenta tissue;2:human MCF-7 Cells.

IHC analysis of Frizzled 4 using anti-Frizzled 4 antibody.Frizzled 4 was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of Frizzled 4 using anti-Frizzled 4 antibody.Frizzled 4 was detected in paraffin-embedded section of human mammary cancer tissue.

IHC analysis of Frizzled 4 using anti-Frizzled 4 antibody.Frizzled 4 was detected in paraffin-embedded section of mouse heart tissue.

IHC analysis of Frizzled 4 using anti-Frizzled 4 antibody.Frizzled 4 was detected in paraffin-embedded section of rat heart tissue.