FPR2 monoclonal antibody (M02), clone 2D8

• Catalog Number: orb2292965
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FPR2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D8
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: FPR2 (AAH29125.1, 163 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
• NCBI: AAH29125.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western Blot detection against Immunogen (30.36 KDa).

FPR2 monoclonal antibody (M02), clone 2D8. Western Blot analysis of FPR2 expression in Hela S3 NE.

Immunofluorescence of monoclonal antibody to FPR2 on HeLa cell. [antibody concentration 10 ug/ml]