FOXF2 monoclonal antibody (M04), clone 2G10

• Catalog Number: orb2293024
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant FOXF2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2G10
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Mouse
• Isotype: IgG2a Kappa
• Immunogen: FOXF2 (NP_001443, 346 a.a. ~ 443 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV
• NCBI: NP_001443
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged FOXF2 is approximately 0.3 ng/ml as a capture antibody.

FOXF2 monoclonal antibody (M04), clone 2G10 Western Blot analysis of FOXF2 expression in HeLa.

FOXF2 monoclonal antibody (M04), clone 2G10. Western Blot analysis of FOXF2 expression in Jurkat.

Immunofluorescence of monoclonal antibody to FOXF2 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (36.89 KDa).